forty7 » deal and competition votes

430

expired [eBook] Free: "Air Fryer Cookbook for Two" ( 250 Easy Recipes.) $0 @ Amazon AU, US

Almost everyone appreciates the trick of air frying since it's less oil and a lot of crisp in a healthy, efficient way. But not everyone cooks for a large family. This is where the air fryer …

1640

expired [eBook] Free - Charles Dickens: The Complete Novels @ Amazon AU

5715 pages This book contains the complete novels of Charles Dickens in the chronological order of their original publication. The Pickwick Papers Oliver Twist Nicholas Nickleby The Old Curiosity …

1880

expired [eBook] Free - The Art of War by Sun Tzu $0 @ Amazon AU

The world's most influential treatise on strategy "The Art of War" is an ancient Chinese military treatise dating from the 5th century BC and is attributed to the ancient Chinese …

1620
[Android, iOS] $0: Railways @ Google Play & Apple App Store (Expired)

expired [Android, iOS] $0: Railways @ Google Play & Apple App Store (Expired)

Railways – Android Railways – iOS (Expired) Do you have a refined taste for games? Are you searching for the ultimate immersive experience in mobile games? Why do you pour the milk …

1162

expired [eBook] Free: "Draw 50 Animals for Beginners and Kids with Simple Shapes" $0 @ Amazon AU, US

Learn to Draw Animals Does your child, tween, or teen love animals and drawing animals? This book will teach them in an easy way how to draw animals of all kinds. It starts with the basics and …

1800

expired [eBook] $0 - Authentic Japanese Recipes | Draw 20 Cartoon Characters @ Amazon AU/US

Free at the time of posting. ebook US link AU link JAPANESE COOKING:: Authentic Japanese Recipes (Japanese Cookbook) US AU HOW TO DRAW 20 CARTOON CHARACTERS: Easy …

1403

expired [eBook] Free - Frankenstein | Great Expectations | The Picture of Dorian Gray | Alice in Wonderland $0 @ Amazon AU US

Frankenstein Mary Shelley began writing Frankenstein when she was only eighteen. At once a Gothic thriller, a passionate romance, and a cautionary tale about the dangers of science, Frankenstein …

1911

expired [eBook] The Complete Brothers Grimm's Fairy Tales (over 200 Fairy Tales and Legends) $0 @ Amazon AU US

The Complete Brothers Grimm's Fairy Tales (over 200 fairy tales and legends) This carefully crafted ebook: "The Complete Brothers Grimm's Fairy Tales (over 200 fairy tales and …

1170

expired [eBook] Free: "Artificial Intelligence and Machine Learning for Business" $0 @ Amazon AU, US

Artificial Intelligence (AI) and Machine Learning are now mainstream business tools. They are being applied across many industries to increase profits, reduce costs, save lives and improve customer …

1320

expired [eBook] Free - Sherlock Holmes: The Ultimate Collection @ Amazon AU/US

Amazon US link. Last free in October 2016. Arthur Conan Doyle’s master criminologist Sherlock Holmes continues to delight readers around the world more than a century after he first appeared …

770

expired [eBook] Free: "A Gardening Guide For Organic Soil Building" $0 @ Amazon AU, US

Energize your garden by cultivating healthy garden soil, the natural way! This gardening guide teaches beginner and intermediate gardeners how to provide healthy soil building strategies to …

1110

expired [eBook] Free - Kick Your Fat in the Nuts | Plant-Based High-Protein Cookbook | The Effective Vegan Instant Pot $0 @ Amazon AU/US

Kick Your Fat in the Nuts AU US Plant-Based High-Protein Cookbook: Quick and Easy Vegan Bodybuilding Diet Book for Athletes to Build Muscles and Achieve Great Athletic Performance with …

3390
[Android, iOS] Free App: Prino Pro (Price Tracking/History) (Was $7.99) @ Google Play / Apple App Store

expired [Android, iOS] Free App: Prino Pro (Price Tracking/History) (Was $7.99) @ Google Play / Apple App Store

I'm using this app quite often now beside OZB. It has price tracking function, price history for hundred stores. Sort by discount % is great. Pro version has no ads, up to 6 months price …

1160
Free Movie Rentals - The Hate U Give, The Secret Life of Bees, Antwone Fisher @ Google Play Store

expired Free Movie Rentals - The Hate U Give, The Secret Life of Bees, Antwone Fisher @ Google Play Store

Google Play have 8 Films Rentals for Free to Inspire Change + Couple of $0.99 options Free Movies Rentals Include The Hate U Give The Secret Life of Bees Murundak: Songs of Freedom Antwone …

1410

expired [eBook] Free - The Curious Case of Benjamin Button | Basmati Recipes: A Delicious Rice Cookbook with Only Basmati @ Amazon AU US

The Curious Case of Benjamin Button (Tales of the Jazz Age): From the author of The Great Gatsby, The Side of Paradise, Tender Is the Night, The Beautiful and Damned and Babylon Revisited US link …

840
Amazon: 10% Cashback (Was 8%) on Alcohol @ Cashrewards

expired Amazon: 10% Cashback (Was 8%) on Alcohol @ Cashrewards

Finishes at 11.59pm. Special Terms Effective 01/06/20, cashback is ineligible on purchase of vouchers, gift cards, kindle unlimited, audible, mobile apps, subscribe & save items, prime …

1130

expired 6 Free Reading Eggs Books @ Amazon AU

Received an email from Reading Eggs stating the following ebooks are now free on Amazon AU for 3 days only. From the email: Expand your child’s library—and their imagination—with these FREE …

1200

expired [eBook] Free: "The Simple Art of Japanese Cooking" $0 @ Amazon AU, US

Japanese cooking has become very popular over the past decades. Food is an important part of Japanese culture, where it has been elevated to an art form, combining textures and colors to …

1060

expired [eBook] Free: "Fascinating Facts for the Whole Family" $0 Amazon AU, US

Authors Note: My aim was to create a compilation of facts suitable for children. This book will entice them into reading and learning new stuff while having fun. I created the popular trivia …

400

expired [eBook] Free - Bwana Kidogo: Scenes from a Colonial Childhood $0 @ Amazon AU / US

US Link here ‘Bwana kidogo, Scenes from a colonial childhood’, is a memoir of Australian writer Chris Durrant about growing up in colonial Kenya in the years after the Second World War. Set …

1720

expired [eBook] Free - Interview Questions and Answers…With Your Future Employer @ Amazon AU / US

Interview Questions and Answers, looking for a new role? US Link https://www.amazon.com/dp/B00OXM6YWE Does the thought of a job interview give you anxiety? If so, then you’re not alone. …

1180

expired [eBook] Free - Lead With No Fear (Expired) | The Wind in the Willows | From Brighton to the Berlin Wall (Exp) @ Amazon AU & US

Continue from previous Speak with no fear, let's Lead With No Fear: - US link Do you desire to grow, improve, and gain new levels of influence as a leader? Are you navigating through the …

1150

expired [eBook] Free: "Chinese Takeout Cookbook" (Your Favorites Chinese Takeout Recipes To Make At Home) $0 @ Amazon AU, US

Learning to make your favorite Chinese takeout dish is easier than you might think. With the right ingredients, great recipes and step-by-step instructions, it can’t be easier than that. And …

1480
Free to Rent Documentaries - I Am Not Your Negro | 3 1/2 Minutes, 10 Bullets | Gurrumul | Westwind | Murundak @ Google & YouTube

expired Free to Rent Documentaries - I Am Not Your Negro | 3 1/2 Minutes, 10 Bullets | Gurrumul | Westwind | Murundak @ Google & YouTube

Normally $4.99 each. Also available on YouTube without having to log in (thanks to simhanada for the info). I Am Not Your Negro - 7.9/10 (16,703 ratings) on IMDb - YouTube Haitian filmmaker …

820

expired [eBook] Free: "101 Quick & Easy Chicken Recipes" $0 @ Amazon AU, US

Product Description Do you eat a lot of chicken? Are you tired of the same old recipes and are looking for something fresh and exciting? Chicken is about as versatile an ingredient as …

2210

expired [eBook] Free - Social Anxiety | Speak with No Fear (Expired) @ Amazon AU / US

Speak With No Fear: Go from a nervous, nauseated, and sweaty speaker to an excited, energized, and passionate presenter AU Link https://www.amazon.com.au/dp/B07SB61VRY Expired US Link …

1070

expired [eBook] Free - Copycat Recipes: Cookbook on How to Make Cracker Barrel Restaurant's Popular Recipes at Home @ Amazon AU / US

US Link —> https://www.amazon.com/dp/B088X54JMD Have you ever wanted to cook meals and dishes at home restaurant style? What if you could prepare your favorite restaurant-style dishes …

890

expired [eBook] Free: "Let's Play Piano: A Complete Course for Young Beginners" $0 @ Amazon AU / US

This brand new piano tutor book will inspire even the youngest beginner. All the basics are covered in easy stages and students will soon be playing simple tunes. The emphasis is on learning to …

1160

expired [eBook] Free Woodworking for Beginners | The Complete Works of William Shakespeare $0 Amazon AU

Woodworking for Beginners: Woodworking Tools & Accessories Kindle Edition US link: https://www.amazon.com/dp/B089XQPTGV Circular Saw, Saber Saw, Table Router, Hand scraper, Belt Sender, …

580

expired [eBook] Free - H. P. Lovecraft: The Complete Fiction @ Amazon AU/ US

Amazon AU - Amazon US 4.7 Rating CONTENTS: The Nameless City The Festival The Colour Out of Space The Call of Cthulhu The Dunwich Horror The Whisperer in Darkness The Dreams in the …

310
[eBook] Divergent Series (Books 1-3) Plus Free Four, The Transfer and World of Divergent $2.99 @ Google, Apple, Amazon, Kobo

expired [eBook] Divergent Series (Books 1-3) Plus Free Four, The Transfer and World of Divergent $2.99 @ Google, Apple, Amazon, Kobo

The Divergent Series By Veronica Roth A complete trilogy of New York Times bestsellers! In a world where everyone must claim a faction, Tris has a dangerous secret that will shake society to its very …

250

expired [eBook] Free: "Cobweb Bride (Cobweb Bride Trilogy Book 1)" @ Amazon

Cobweb Bride By Vera Nazarian Was $5.47, Now Free In this enchanting, utterly captivating tale from a Nebula Award–nominated author, Death has stopped gathering souls from the realm of the living …

2170

expired [eBook] $0 - How to Draw Cool Stuff | Drawing Dimension - Shading Techniques @ Amazon AU/US

Free at the time of posting. ebook US link AU link How to Draw Cool Stuff: A Drawing Guide for Teachers and Students US AU Drawing Dimension - Shading Techniques: A …

770

expired [eBook] Free: "Raspberry Pi: Beginners’ Guide" (Everything You Need to Know About Raspberry Pi) $0 @ Amazon AU, US

This book contains lots of valuable information that will improve your general understanding of the Raspberry Pi, and the book contains many explanations that will help you understand the …

630

out of stock Grey Goose Vodka - 700ml $59.90 Delivered @ Amazon AU

Solid price on Grey Goose. Ordered yesterday delivered first thing this morning. Cheers Steve Mod: OP posted without declaring association with product (sockpuppeting), user is banned and …

1240

expired [eBook] $0 eBooks - Excel, 50 Masterpieces, H. P. Lovecraft, Tao Te Ching, Music Theory @ Amazon AU/US

A selection of ebooks free at the time of posting. ebook US link AU link Excel Formulas and Functions 2020: The Step by Step Excel Guide with Examples on How to Create Powerful …

920
[iOS, Android] Free: "Legend of The Moon RPG" $0 @ Apple App Store & Google Play

expired [iOS, Android] Free: "Legend of The Moon RPG" $0 @ Apple App Store & Google Play

Classic dungeon exploring action RPG. For those who get sick and tired of endless and meaningless level up we developed it so they can get nostalgic about the moment you held a controller to see …

1002
Guzman Y Gomez (Expired) | McDonald's (Fri-Sun, Min Spend $25) - Free Delivery via Uber Eats

expired Guzman Y Gomez (Expired) | McDonald's (Fri-Sun, Min Spend $25) - Free Delivery via Uber Eats

GYGDELIVERYGYGFREEDELMACCASWIN

Source - Yes, you’ve got that right, Free Delivery is back with our pals over at Uber Eats and this time there is no limit to the amount of times you can get Free Delivery with no minimum spend …

844
Unlimited Free Delivery on Domino's and Everyday by bp Orders (Min Spend $15) @ Uber Eats

expired Unlimited Free Delivery on Domino's and Everyday by bp Orders (Min Spend $15) @ Uber Eats

FREEDELDOMINOSeverydayfree

Dominos: This offer is for free delivery on your order via the Uber Eats app (Offer). To redeem this Offer, open the Uber Eats app, apply the promo code FREEDELDOMINOS to your account, search for a …

110
Unlimited Free Delivery on Orders over $50 until June 30th @ Uber Eats (Blue Rewards Members)

expired Unlimited Free Delivery on Orders over $50 until June 30th @ Uber Eats (Blue Rewards Members)

Hey everyone, not sure if random minimum spent, $50 is what I am getting. And not sure if have to order to get this. Ordered Uber eats before only when I was given coupon code, so 2nd last order was …

740
Free Delivery from Oporto @ UberEATS

expired Free Delivery from Oporto @ UberEATS

LOVEOPORTO

Free delivery from Oporto on UberEATS at participating stores. Expires 19/06/20. Repeat of this popular deal. Terms & Conditions – This offer is for free delivery on your order via the Uber …

830

expired [Kindle] - Free eBook - Stranger Things: SIX #1 and other Stranger Things Comics @ Amazon AU

Needing your dose of Stranger Things: A few free kindle version of comics @Amazon Au Stranger Things: SIX #1 Kindle & comiXology by Jody Houser (Author), Aleksi Briclot (Cover Art), Edgar …

1530

expired [eBook] Free - The Great Gatsby @ Amazon AU

I actually read this one! . One of the all time greats by y F. Scott Fitzgerald US edition here Another one thanks to mouthFlappers Philosophers Scott Francis …

1810
[Prime] Just Mercy Free to Rent (UHD 4K) @ Prime Video

expired [Prime] Just Mercy Free to Rent (UHD 4K) @ Prime Video

As with the Microsoft deal, it's now free to rent on Amazon prime as well. Seems to be a better option since I can stream it directly on my smart TV this way. Expect this to also be available …

870

expired [eBook] Free: "1123 Hard to Believe Facts" $0 @ Amazon

Following the success of my site http://www.RaiseYourBrain.com and numerous requests from readers, I decided to compile some of the most interesting facts in a book. That's why I decided to …

670

expired Allen's Red Skins 800g $5.45 + Delivery ($0 with Prime/ $39 Spend) @ Amazon AU

Saw the Post of Allen's Snakes and then did a bit of search for the better Allen's Lollies (sadly no Fantales) This is my first post so please be kind.

900
Free Regular Chips & 600ml Drink with Loaded Parma Purchase $15 @ Schnitz via Menulog

expired Free Regular Chips & 600ml Drink with Loaded Parma Purchase $15 @ Schnitz via Menulog

The experts at Schnitz have launched new LOADED PARMAS. And to celebrate, until June 7, when you order one you can add a free regular chips and 600ml drink to your order. Choose from a …

970

expired [eBook] Free: "Vegan Cookbook: Delicious Vegan Gluten-free Recipes" $0 @ Amazon

Following a vegan gluten-free diet is extremely challenging and often very expensive. Gluten-free foods are hard to find, do not always taste very good and many people who have to avoid gluten …

2250
MUBI Film Schools Program - Free 12 Months Subscription (Was $71.88) | FarFaria - 6 Months @ Scribd

expired MUBI Film Schools Program - Free 12 Months Subscription (Was $71.88) | FarFaria - 6 Months @ Scribd

Just saw this deal on HUKD which is similar to this deal (credit to NotaCommentator). Steps - 1) Sign up to a free 30 day trial with Scribd. Disregard the message that the promo is ended. You need …

320
[iOS] 10% Bonus When Adding Funds to Your Apple ID

expired [iOS] 10% Bonus When Adding Funds to Your Apple ID

This deal is back again. Of course it's not as good as those 15%/20% off gift cards but this is the best deal at the moment. Instructions on Apple devices: Go to App Store on your home screen, …