morediscount » deal and competition votes
830
Tasty hot sauce recipes: Store bought hot sauces are good but homemade hot sauces taste better. They are fresher and spicier. Making hot sauces is easy, this book contains a couple of recipes …
610
PGGB09
was $79 now $19, 200 units only, 2 colours available
3110
Usually costing ~$6, this game is now currently free at the Microsoft Store Farming Simulator 16 allows you to manage your own realistic farm in extraordinary detail. Plant, grow, harvest, and sell …
1410
Sorry for the delay and the rustic wet look. Iso Lyf got me forgetting to check my mail. A few nice picks this week for those that want to get outside and get fit, and for those that want the exact …
1150
PAICB09
$49 for 12 bottles- that's only $4.08 per bottle including delivery! This is one of our most popular red mixed wine bundle on eBay. Always receives excellent feedback and multiple purchases from …
019
Aqium Instant Hand Sanitiser Make aqium a part of your Daily hand hygiene routine It offers a quick and convenient way to sanitise your hands on the go Is a hospital strength formula Kills 99.99% …
31337
Upcoming ebay plus sales have been announced - Expired Friday, June 26: Samsung Galaxy A70 (128GB) - $299 (was $549) - 500 units available - 2pm & 4pm Friday, June 26: Samsung Galaxy Tab A …
- 1509
- Other
- 26 Jun 2020 4:28pm
130
I stumbled across this random deal. Philips colour bulb $59, both bayonet and edison screw fittings. Note that this is the previous bulb, and NOT the new one that includes bluetooth. However, given …
50
Found this while browsing smart products , not sure how good it is though. Original Price showing as $39 Key Features: Works with Google Assistant and/or Amazon Alexa Secure your home. Detect …
100
Hi all: Got an email from menulog advising "Every Thursday in the month of June, head to the 'For You' section on your Menulog app or go to www.menulog.com.au/offers on web to find …
140
PBOTTLE
10% off $50 spend if you use math. Plenty of bargains out there, especially when you factor in free delivery. Selected Sellers: Boozebud Australia Coffeeandwineco CUB Beer Dan …
1430
Unlock 3000 bonus points* plus 30 days free Delivery when you subscribe to Delivery Unlimited! Delivery Unlimited covers the costs of delivery and packaging fees on orders over $100# with a monthly …
1680
Another upcoming free to keep game from Steam. Available from 9/6 at 5pm. Play as Kao! The cutest and bravest kangaroo of all video games returns in this digital version of “Kao the Kangaroo: …
- 17
- Gaming
- Freebie
- 15 Jun 2020 3:00pm
2030
This Saturday only! You know the drill. It’s 100% Aussie Beef with our signature special sauce. Let’s make it a meal and double it – all for just $8! Grab yours tomorrow, exclusive to the …
68820
Fun starts June 1. Stay safe, and enjoy :) 29 May 2020: ebay.com.au, Australia’s number one shopping site, is launching its first-ever month-long shopping event, eBay Plus Month, offering huge …
- 2054
- Other
- 25 Jun 2020 12:31pm
190
BACKTOWIN
VPN to UK may be require Sky customers across the UK can enjoy LaLiga’s return for FREE on LaLigaTV 24/7 channel offering all LIVE matches from Spain’s top division to be available to Sky …
1480
PTESTGOOD
Greetings everyone, another eBay sale to take advantage of :) LG OLED65CXPTA 65" CX 4K UHD SMART CINEMA OLED TV $3596 C&C (Or + Delivery) LG OLED55CXPTA 55" CX 4K UHD SMART …
- 176
- Other
- 29 May 2020 10:26am
40
Tandoori Palace at Darlinghurst is offering 40% OFF total takeaway bill for food and drinks Daily via EatClub App Download app here: https://eatclub.com.au/ No code required. For latest deals …
270
Saw this just now. What a bargain! Not sure when it expires or if it's nation/state wide. [edit] Was in the Noosa Coles again today (12.30pm), they still have HEAPS of them :)
70
Comfort Amber & Rose 1.9L laundry conditioner has natural fragrance oils Comfort Amber & Rose fabric conditioner has a warm oriental fragrance with hints of mixed flowers Comfort Aromatherapy …
This deal is not published.
Samsung 860 EVO 1TB SATA 2.5" SSD $159 + Free Delivery @ Centrecom (Unobtainable deal)
6310
While stocks last. T&Cs here. Stay safe, and enjoy :)
80
Original price: $29.99 Sale price: $12.99 MOSSY OAK Tactical LED Flashlight Shock-Proof 300 Lumens and Headlamp 200 Lumens, Battery Powered Helmet Light Combo Kit for Camping, Running, Hiking and …
1230
. Coupon code will be issued before the commencement of Sony Frenzy on 19/05/2020 and is valid until 11:59PM (AEST) 25/05/2020. Only available for a single transaction at Sony Online Store. In order …
23020
Epic Games have confirmed on Twitter that Grand Theft Auto 5 will be the next free game. Get Grand Theft Auto V free on PC until May 21. Yours to keep forever on the Epic Games Store. Here is the …
- 589
- Gaming
- Freebie
- 11 Jun 2020
1610
Some cookbooks that were free at the time of posting. ebook US link AU link Indian Cooking: Learn Authentic Indian Cooking with Easy Indian Recipes US AU Japanese …
250
It is $4 but $3.60 with Subscribe and Save. Description: Satisfies your hunger 10g protein per bar Gluten free No artificial colours of flavours Note: $6.30 at …
750
There is nothing that comes close to the smell of bacon cooking. If you want to find new ways to cook with one of your favorite meats then Bacon Cookbook: 150 Easy Bacon Recipes is the book for …
190
Lightning Deal - Pink $8.66, other colours $11.55 - Reg price $16.99 Product Dimensions - 26.5x22.9x11.4cm
2240
Another Steam freebie to keep. Available 3am 22/05. 10 SECOND NINJA X is a shockingly fast, overwhelmingly intense action/puzzle game. In this thumb blistering sequel, the nefarious Captain …
- 16
- Gaming
- Freebie
- 29 May 2020 3:00am
4000
Free while supplies last or until 3am AEST on Monday the 11th of May. There is also a key redemption deadline of 3am AEST on Friday the 15th of May after you've claimed the game. As usual with …
- 61
- Gaming
- Freebie
- 11 May 2020 3:00am
1002
GYGDELIVERYGYGFREEDELMACCASWIN
Source - Yes, you’ve got that right, Free Delivery is back with our pals over at Uber Eats and this time there is no limit to the amount of times you can get Free Delivery with no minimum spend …
1331
I have seen the recent post of Cities Skylines for less than $8 (What a bargain!) and went to check the DLCs. https://www.ozbargain.com.au/node/531548 <—Get it for less than $8!!! Cities: …
390
Wet Ones Be Gentle Travel Pack, 15 Wipes https://www.amazon.com.au/ONES-GENTLE-TRAVEL-PACK-15CT/dp/B0... and Wet Ones Be Fresh Travel Pack, 15 …
This deal is not published.
Hand sanitizer 500ml %75 alcohol (Spam)
1370
Stay safe :) We wanted to assure you all that we’re offering food for free to vulnerable members in our community who are struggling with the ever-changing COVID-19 pandemic situation. The huge …
890
Saw this available on KG Eletronics eBay store, price is a little more than Chemist Warehouse per bottle at the moment but you won't be able to find stock anywhere. Plus this is 6 bottles which …
440
Surface Cleanser Trigger Kills 99% of germs* Removes 90% of allergens** Great for use on surfaces where food is prepared, stored and eaten No need to rinse Non bleach *Germs such as: Salmonella, …
111
Antibacterial Hand Sanitisers - 75% Ethyl Alcohol with moisturiser. Contains 75% Ethyl Alcohol with Glycerine, Pure Essential Oils (Lavender, Eucalyptus & Lemon Myrtle) & distilled …
260
SBI Sydney is offering Zero remittance fee on AUD-INR transactions for those who are : - Supporting their families and friends back in India to fight COVID-19 - Donating funds to PM Cares Fund to …
1530
STAYINSIDEANDLEARN2
2020 Launch! Learn how to hack like a pro by a pro. Up to date practical hacking techniques with absolutely no filler. HIGHEST RATED 4.7 (4,062 ratings) 26,590 students enrolled What you'll …
2070
Greetings everyone, just spotted this on the front page at Amazon :) Amazon have reduced heaps of childrens and fiction eBooks to help out during this crisis! A selection of free Kindle Books …
970
KLEENEX Facial Special Care Tissues With Aloe Vera and Vitamin E, 1 Box of 95 tissues $1.99 Alternate option: KLEENEX Facial Special Care Aloe Vera & Vitamin E Facial Tissues, 140 sheets $3.00
1920
Similar to yesterday’s post, another incredible gesture of goodwill. Stay safe :) “FOOD FOR HOPE”. We are here for you Mackay - warm meal for anyone who has lost their job or business! In …
1020
Something from Hasbro to get us through the self isolation. Nearly seven hours of GI Joe joy. Let’s revisit the 90s… G.I. JOE: A Real American Hero follows an elite team of soldiers as …
1502
Greetings everyone, this seems like a pretty great price on this game to me :) The Division 2 Playstation 4 Devil May Cry 5 is also $8 In-Store Only. PS4. Star Wars Jedi Fallen Order is …
This deal is not published.
Three-Layer CE Listed Face Mask (50 Pack) - US $19.5 / AU $31.92 Delivered @JASGOOD
(Spam)
1320
WFH and learning something new daily during these time so here is collection of some useful good courses for everyone. All codes are already added. Stay Safe. Credit to FB Udemy Group and many other …
210
LPFREEDEL
La Porchetta offering free delivery since their dining rooms are closed due to lockdown :)
1960
We nearly lost our Aussie icon during the recent bushfire (remember that?). As reported - Lone Pine Koala Sanctuary near Brisbane, Queensland, currently has 15 livestreams running, eight of …
- 22
- Other
- Freebie
- 19 Sep 2023 3:20pm