morediscount » deal and competition votes

830

expired [eBook] Free - Tasty Hot Sauce Recipes | Penguins! (Discover Your World Series) | Easy Container Gardening @ Amazon AU

Tasty hot sauce recipes: Store bought hot sauces are good but homemade hot sauces taste better. They are fresher and spicier. Making hot sauces is easy, this book contains a couple of recipes …

610
[eBay Plus] KitchenAid Classic Two Slice Toaster $19 (Was $79) @ Peter's of Kensington eBay

out of stock [eBay Plus] KitchenAid Classic Two Slice Toaster $19 (Was $79) @ Peter's of Kensington eBay

PGGB09

was $79 now $19, 200 units only, 2 colours available

3110

expired [PC, Android] Farming Simulator 16 - Free @ Microsoft Store | Google Play

Usually costing ~$6, this game is now currently free at the Microsoft Store Farming Simulator 16 allows you to manage your own realistic farm in extraordinary detail. Plant, grow, harvest, and sell …

1410
Down Jacket $49.99, Merino Thermals $29.99/pc, Outdoor Pants $24.99, Hiking Pack $34.99, Hiking Shoe $29.99 @ ALDI Special Buys

expired Down Jacket $49.99, Merino Thermals $29.99/pc, Outdoor Pants $24.99, Hiking Pack $34.99, Hiking Shoe $29.99 @ ALDI Special Buys

Sorry for the delay and the rustic wet look. Iso Lyf got me forgetting to check my mail. A few nice picks this week for those that want to get outside and get fit, and for those that want the exact …

1150
[eBay Plus] Winter Warmer Mixed Aussie Red Dozen Feat. Wolf Blass Shiraz $49 Delivered (Was $85) @ Coffeeandwineco

expired [eBay Plus] Winter Warmer Mixed Aussie Red Dozen Feat. Wolf Blass Shiraz $49 Delivered (Was $85) @ Coffeeandwineco

PAICB09

$49 for 12 bottles- that's only $4.08 per bottle including delivery! This is one of our most popular red mixed wine bundle on eBay. Always receives excellent feedback and multiple purchases from …

019
Aqium 1L Hand Sanitiser $29.50 (+ $14.99 Delivery) @ Tassway

expired Aqium 1L Hand Sanitiser $29.50 (+ $14.99 Delivery) @ Tassway

Aqium Instant Hand Sanitiser Make aqium a part of your Daily hand hygiene routine It offers a quick and convenient way to sanitise your hands on the go Is a hospital strength formula Kills 99.99% …

31337
[eBay Plus] Apple Watch S5 $399, AirPods Pro $249, Galaxy Tab A 10.1 $199, Galaxy A70 $299, Slow Cooker $29, Thermometer $49

expired [eBay Plus] Apple Watch S5 $399, AirPods Pro $249, Galaxy Tab A 10.1 $199, Galaxy A70 $299, Slow Cooker $29, Thermometer $49

Upcoming ebay plus sales have been announced - Expired Friday, June 26: Samsung Galaxy A70 (128GB) - $299 (was $549) - 500 units available - 2pm & 4pm Friday, June 26: Samsung Galaxy Tab A …

130
Philips Hue White and Colour Ambience Bulbs (B22+E27) $59, Go Portable $119 @ EB Games

expired Philips Hue White and Colour Ambience Bulbs (B22+E27) $59, Go Portable $119 @ EB Games

I stumbled across this random deal. Philips colour bulb $59, both bayonet and edison screw fittings. Note that this is the previous bulb, and NOT the new one that includes bluetooth. However, given …

50
Lenovo Smart Door/Window Sensor $31 + Delivery @ JB Hi-Fi

expired Lenovo Smart Door/Window Sensor $31 + Delivery @ JB Hi-Fi

Found this while browsing smart products , not sure how good it is though. Original Price showing as $39 Key Features: Works with Google Assistant and/or Amazon Alexa Secure your home. Detect …

100
Multiple 'Personalised' Offers, (Free Shipping, $ off etc) @ Menulog

expired Multiple 'Personalised' Offers, (Free Shipping, $ off etc) @ Menulog

Hi all: Got an email from menulog advising "Every Thursday in the month of June, head to the 'For You' section on your Menulog app or go to www.menulog.com.au/offers on web to find …

140
[eBay Plus] $5 off $50 Spend Beer & Wine (e.g. Matilda Bay Frothy Beer 24x375ml $45 Delivered) @ eBay

expired [eBay Plus] $5 off $50 Spend Beer & Wine (e.g. Matilda Bay Frothy Beer 24x375ml $45 Delivered) @ eBay

PBOTTLE

10% off $50 spend if you use math. Plenty of bargains out there, especially when you factor in free delivery. Selected Sellers: Boozebud Australia Coffeeandwineco CUB Beer Dan …

1430
Sign up to Woolworths Delivery 30 Day Trial & Receive 3000 Woolworths Reward Points

expired Sign up to Woolworths Delivery 30 Day Trial & Receive 3000 Woolworths Reward Points

Unlock 3000 bonus points* plus 30 days free Delivery when you subscribe to Delivery Unlimited! Delivery Unlimited covers the costs of delivery and packaging fees on orders over $100# with a monthly …

1680
[PC] Free - Kao The Kangaroo: Round 2 @ Steam

expired [PC] Free - Kao The Kangaroo: Round 2 @ Steam

Another upcoming free to keep game from Steam. Available from 9/6 at 5pm. Play as Kao! The cutest and bravest kangaroo of all video games returns in this digital version of “Kao the Kangaroo: …

2030
$8 for 2 Small Big Mac Meals @ McDonald's via mymacca's App

expired $8 for 2 Small Big Mac Meals @ McDonald's via mymacca's App

This Saturday only! You know the drill. It’s 100% Aussie Beef with our signature special sauce. Let’s make it a meal and double it – all for just $8! Grab yours tomorrow, exclusive to the …

68820
eBay Plus Month: AirPods 2 $99, AirPods Pro $249, Galaxy A70 $299, SodaStream $19, Xiaomi Purifier $179, Neon Switch + Game $449

expired eBay Plus Month: AirPods 2 $99, AirPods Pro $249, Galaxy A70 $299, SodaStream $19, Xiaomi Purifier $179, Neon Switch + Game $449

Fun starts June 1. Stay safe, and enjoy :) 29 May 2020: ebay.com.au, Australia’s number one shopping site, is launching its first-ever month-long shopping event, eBay Plus Month, offering huge …

190
La Liga Games to Be Broadcast throughout June for Free for Everyone @ Sky Sports (VPN Possibly Required)

expired La Liga Games to Be Broadcast throughout June for Free for Everyone @ Sky Sports (VPN Possibly Required)

BACKTOWIN

VPN to UK may be require Sky customers across the UK can enjoy LaLiga’s return for FREE on LaLigaTV 24/7 channel offering all LIVE matches from Spain’s top division to be available to Sky …

1480
20% off @ The Good Guys eBay (E.G LG OLED 65CX $3596, 55CX $2636, 65BX $3196, GoPro Hero 8 $399.20 C&C (Or + Delivery))

expired 20% off @ The Good Guys eBay (E.G LG OLED 65CX $3596, 55CX $2636, 65BX $3196, GoPro Hero 8 $399.20 C&C (Or + Delivery))

PTESTGOOD

Greetings everyone, another eBay sale to take advantage of :) LG OLED65CXPTA 65" CX 4K UHD SMART CINEMA OLED TV $3596 C&C (Or + Delivery) LG OLED55CXPTA 55" CX 4K UHD SMART …

40
[NSW] 40% off Takeaway @ Tandoori Palace via EatClub App (5.30pm-9.30pm Daily)

expired [NSW] 40% off Takeaway @ Tandoori Palace via EatClub App (5.30pm-9.30pm Daily)

Tandoori Palace at Darlinghurst is offering 40% OFF total takeaway bill for food and drinks Daily via EatClub App Download app here: https://eatclub.com.au/ No code required. For latest deals …

270
[QLD] Tim Tams Double Coated $1 @ Coles Noosa

expired [QLD] Tim Tams Double Coated $1 @ Coles Noosa

Saw this just now. What a bargain! Not sure when it expires or if it's nation/state wide. [edit] Was in the Noosa Coles again today (12.30pm), they still have HEAPS of them :)

70

expired Comfort Aromatherapy Fabric Conditioner Amber&Rose, 1.9L $7.96 (Subscribe&Save) + Delivery ($0 with Prime/ $39 Spend) @ AmazonAU

Comfort Amber & Rose 1.9L laundry conditioner has natural fragrance oils Comfort Amber & Rose fabric conditioner has a warm oriental fragrance with hints of mixed flowers Comfort Aromatherapy …

This deal is not published.
Samsung 860 EVO 1TB SATA 2.5" SSD $159 + Free Delivery @ Centrecom (Unobtainable deal)
6310
Free A5 Post-it Dry Erase Surface Sample Delivered @ 3M

out of stock Free A5 Post-it Dry Erase Surface Sample Delivered @ 3M

While stocks last. T&Cs here. Stay safe, and enjoy :)

80

expired MOSSY OAK Tactical LED Flashlight Torch & Headlamp Set $12.99 + Delivery ($0 with Prime/ $39+) @ Greatstar Tools Amazon AU

Original price: $29.99 Sale price: $12.99 MOSSY OAK Tactical LED Flashlight Shock-Proof 300 Lumens and Headlamp 200 Lumens, Battery Powered Helmet Light Combo Kit for Camping, Running, Hiking and …

1230

expired $20 off Your Sony "Click Frenzy" Purchase (Min Spend $50) @ Sony

. Coupon code will be issued before the commencement of Sony Frenzy on 19/05/2020 and is valid until 11:59PM (AEST) 25/05/2020. Only available for a single transaction at Sony Online Store. In order …

23020
[PC] Free - $15 off Coupon (Min $22.99 Spend) | Grand Theft Auto V Premium Edition (Expired) @ Epic Games

expired [PC] Free - $15 off Coupon (Min $22.99 Spend) | Grand Theft Auto V Premium Edition (Expired) @ Epic Games

Epic Games have confirmed on Twitter that Grand Theft Auto 5 will be the next free game. Get Grand Theft Auto V free on PC until May 21. Yours to keep forever on the Epic Games Store. Here is the …

1610

expired [eBook] $0 Cookbooks - Indian, Vietnamese, Japanese @ Amazon AU/US

Some cookbooks that were free at the time of posting. ebook US link AU link Indian Cooking: Learn Authentic Indian Cooking with Easy Indian Recipes US AU Japanese …

250

expired Carman's Protein Bar Coconut,Yoghurt&Roasted Nut 200g $3.60 (S&S) + Delivery ($0 with Prime/ $39 Spend) @ Amazon AU

It is $4 but $3.60 with Subscribe and Save. Description: Satisfies your hunger 10g protein per bar Gluten free No artificial colours of flavours Note: $6.30 at …

750

expired [eBook] Free: Bacon Cookbook - 150 Easy Bacon Recipes $0 @ Amazon

There is nothing that comes close to the smell of bacon cooking. If you want to find new ways to cook with one of your favorite meats then Bacon Cookbook: 150 Easy Bacon Recipes is the book for …

190

expired Reusable Lunch Bag, Insulated Lunch Box $11.55 + Delivery ($0 with Prime/ $39 Spend) @ H.T Store Amazon AU

Lightning Deal - Pink $8.66, other colours $11.55 - Reg price $16.99 Product Dimensions - 26.5x22.9x11.4cm

2240
[PC] Free - 10 Second Ninja X (Was $14.50) @ Steam

expired [PC] Free - 10 Second Ninja X (Was $14.50) @ Steam

Another Steam freebie to keep. Available 3am 22/05. 10 SECOND NINJA X is a shockingly fast, overwhelmingly intense action/puzzle game. In this thumb blistering sequel, the nefarious Captain …

4000
[PC, Steam] Free Ashes of the Singularity: Escalation at Humble Bundle

expired [PC, Steam] Free Ashes of the Singularity: Escalation at Humble Bundle

Free while supplies last or until 3am AEST on Monday the 11th of May. There is also a key redemption deadline of 3am AEST on Friday the 15th of May after you've claimed the game. As usual with …

1002
Guzman Y Gomez (Expired) | McDonald's (Fri-Sun, Min Spend $25) - Free Delivery via Uber Eats

expired Guzman Y Gomez (Expired) | McDonald's (Fri-Sun, Min Spend $25) - Free Delivery via Uber Eats

GYGDELIVERYGYGFREEDELMACCASWIN

Source - Yes, you’ve got that right, Free Delivery is back with our pals over at Uber Eats and this time there is no limit to the amount of times you can get Free Delivery with no minimum spend …

1331
[PC] 3 Free DLCs for Cities Skylines @ Steam

expired [PC] 3 Free DLCs for Cities Skylines @ Steam

I have seen the recent post of Cities Skylines for less than $8 (What a bargain!) and went to check the DLCs. https://www.ozbargain.com.au/node/531548 <—Get it for less than $8!!! Cities: …

390

out of stock 'Wet Ones' Be Gentle Travel Pack Antibacterial Wipes (Sensitive or Original) 15 Wipes $1.99 + Post ($0 with Prime) @ Amazon

Wet Ones Be Gentle Travel Pack, 15 Wipes https://www.amazon.com.au/ONES-GENTLE-TRAVEL-PACK-15CT/dp/B0... and Wet Ones Be Fresh Travel Pack, 15 …

This deal is not published.
Hand sanitizer 500ml %75 alcohol (Spam)
1370
[TAS] Free Indian Takeaway Meals for Needy/Elderly/Jobless @ Bombay on the Beach, Blackmans Bay (also Sikh Temple Hobart see OP)

expired [TAS] Free Indian Takeaway Meals for Needy/Elderly/Jobless @ Bombay on the Beach, Blackmans Bay (also Sikh Temple Hobart see OP)

Stay safe :) We wanted to assure you all that we’re offering food for free to vulnerable members in our community who are struggling with the ever-changing COVID-19 pandemic situation. The huge …

890
6x Dettol 200ml Instant Hand Gel Sanitizer Refresh Antibacterial Sanitiser Pump $49 Delivered @ KG Electronics eBay AU

out of stock 6x Dettol 200ml Instant Hand Gel Sanitizer Refresh Antibacterial Sanitiser Pump $49 Delivered @ KG Electronics eBay AU

Saw this available on KG Eletronics eBay store, price is a little more than Chemist Warehouse per bottle at the moment but you won't be able to find stock anywhere. Plus this is 6 bottles which …

440

out of stock 2 x Dettol Antibacterial Surface Cleanser Trigger Spray Lime & Mint 500ml - $8 + Delivery ($0 with Prime/$39+) @ Amazon AU

Surface Cleanser Trigger Kills 99% of germs* Removes 90% of allergens** Great for use on surfaces where food is prepared, stored and eaten No need to rinse Non bleach *Germs such as: Salmonella, …

111
75% Ethyl Alcohol Hand Sanitisers - 100ml $9.95 + $10 Delivery (Free with $100) @ Wild Balance Oils

expired 75% Ethyl Alcohol Hand Sanitisers - 100ml $9.95 + $10 Delivery (Free with $100) @ Wild Balance Oils

Antibacterial Hand Sanitisers - 75% Ethyl Alcohol with moisturiser. Contains 75% Ethyl Alcohol with Glycerine, Pure Essential Oils (Lavender, Eucalyptus & Lemon Myrtle) & distilled …

260
$0 Remittance Fee for Money Transfer Supporting Friends/Families in India to Fight COVID19 @ SBISydney

expired $0 Remittance Fee for Money Transfer Supporting Friends/Families in India to Fight COVID19 @ SBISydney

SBI Sydney is offering Zero remittance fee on AUD-INR transactions for those who are : - Supporting their families and friends back in India to fight COVID-19 - Donating funds to PM Cares Fund to …

1530

expired Free Course - Practical Ethical Hacking - The Complete Course @ Udemy

STAYINSIDEANDLEARN2

2020 Launch! Learn how to hack like a pro by a pro. Up to date practical hacking techniques with absolutely no filler. HIGHEST RATED 4.7 (4,062 ratings) 26,590 students enrolled What you'll …

2070

expired [Kindle] 173 Free Childrens and Fiction eBooks @ Amazon AU

Greetings everyone, just spotted this on the front page at Amazon :) Amazon have reduced heaps of childrens and fiction eBooks to help out during this crisis! A selection of free Kindle Books …

970

expired Kleenex Facial Special Care Tissues With Aloe Vera and Vitamin E 95pcs $1.99 + Delivery ($0 with Prime/ $39 Spend) @ Amazon AU

KLEENEX Facial Special Care Tissues With Aloe Vera and Vitamin E, 1 Box of 95 tissues $1.99 Alternate option: KLEENEX Facial Special Care Aloe Vera & Vitamin E Facial Tissues, 140 sheets $3.00

1920
[QLD] Free Takeaway Food for Jobless @ Roshni Indian Restaurant Mackay

expired [QLD] Free Takeaway Food for Jobless @ Roshni Indian Restaurant Mackay

Similar to yesterday’s post, another incredible gesture of goodwill. Stay safe :) “FOOD FOR HOPE”. We are here for you Mackay - warm meal for anyone who has lost their job or business! In …

1020
Free - 15 Episodes of G.I. Joe: A Real American Hero @ Hasbro YouTube

expired Free - 15 Episodes of G.I. Joe: A Real American Hero @ Hasbro YouTube

Something from Hasbro to get us through the self isolation. Nearly seven hours of GI Joe joy. Let’s revisit the 90s… G.I. JOE: A Real American Hero follows an elite team of soldiers as …

1502
[PS4, XB1] The Division 2 $3, SW: Jedi Fallen Order $39 C&C (Or + Delivery),  Devil May Cry 5 $8 (In-Store) @ Harvey Norman

expired [PS4, XB1] The Division 2 $3, SW: Jedi Fallen Order $39 C&C (Or + Delivery), Devil May Cry 5 $8 (In-Store) @ Harvey Norman

Greetings everyone, this seems like a pretty great price on this game to me :) The Division 2 Playstation 4 Devil May Cry 5 is also $8 In-Store Only. PS4. Star Wars Jedi Fallen Order is …

This deal is not published.
Three-Layer CE Listed Face Mask (50 Pack) - US $19.5 / AU $31.92 Delivered @JASGOOD (Spam)
1320

expired Free Udemy & Eduonix Courses: Python Bootcamp 2020, Unity 3D Game Development, Excel Photoshop, JavaScript, PHP & Mysql and More

WFH and learning something new daily during these time so here is collection of some useful good courses for everyone. All codes are already added. Stay Safe. Credit to FB Udemy Group and many other …

210
[VIC, QLD] Free Delivery with $20 Min Spend @ La Porchetta

expired [VIC, QLD] Free Delivery with $20 Min Spend @ La Porchetta

LPFREEDEL

La Porchetta offering free delivery since their dining rooms are closed due to lockdown :)

1960
Free Live Stream of Koalas @ Lone Pine Koala Sanctuary

expired Free Live Stream of Koalas @ Lone Pine Koala Sanctuary

We nearly lost our Aussie icon during the recent bushfire (remember that?). As reported - Lone Pine Koala Sanctuary near Brisbane, Queensland, currently has 15 livestreams running, eight of …